Skills DirectorySkills Directory
SkillsLearnSecurityCategoriesDocsCommunityBlog
Sign InSubmit Skill
Skills Directory

Security-tested agent skills for Claude, coding agents, and AI workflows.

Directory

  • Browse Skills
  • All Skills A–Z
  • Claude Skills
  • Claude Code Skills
  • Agent Skills
  • Categories
  • Authors
  • Submit a Skill

Learn

  • Learn Hub
  • Install Claude Skills
  • Write SKILL.md
  • Skills vs MCP
  • Directories Compared

Security

  • Security
  • Methodology
  • Secure Claude Skills
  • Security Badges

Company

  • About
  • Community
  • Blog
  • API Docs
  • Advertise

2026 Skills Directory. All rights reserved.

ProTermsPrivacyRefunds
Back to skills

Modern Structure Prediction

ASecurity

Predict protein structures using modern ML models including AlphaFold3, ESMFold, Chai-1, and Boltz-1. Use when predicting structures for novel proteins, protein complexes, or when comparing predictions across multiple methods.

171 stars
0 votes
0 copies
0 views
Added 5/29/2026
datapythongobashapi

Works with

cliapi

Security Analysis

A96/100
mediumInstalls packages at runtime which could introduce malicious dependencies

Scanned 5/29/2026

Install to Claude Code

$npx -y skills add BioTender-max/awesome-bio-agent-skills --skill modern-structure-prediction --agent claude-code

Installs into .claude/skills of the current project.

Are you the author of Modern Structure Prediction?

Add the live security badge to your README — it updates automatically with every re-scan.

Security grade badge for Modern Structure Prediction
[![Security: A — Skills Directory](https://www.skillsdirectory.com/api/skills/biotender-max-modern-structure-prediction/badge)](https://www.skillsdirectory.com/skills/biotender-max-modern-structure-prediction)

More formats (shields.io, HTML) on the badges page.

Download with Pro
Files
SKILL.md
---
name: bio-structural-biology-modern-structure-prediction
description: Predict protein structures using modern ML models including AlphaFold3, ESMFold, Chai-1, and Boltz-1. Use when predicting structures for novel proteins, protein complexes, or when comparing predictions across multiple methods.
tool_type: python
primary_tool: ESMFold
---

## Version Compatibility

Reference examples tested with: BioPython 1.83+, numpy 1.26+

Before using code patterns, verify installed versions match. If versions differ:
- Python: `pip show <package>` then `help(module.function)` to check signatures
- CLI: `<tool> --version` then `<tool> --help` to confirm flags

If code throws ImportError, AttributeError, or TypeError, introspect the installed
package and adapt the example to match the actual API rather than retrying.

# Modern Structure Prediction

**"Predict the structure of my protein"** → Run ML-based structure prediction using ESMFold (single-sequence, fast), AlphaFold3 (MSA-based, highest accuracy), Chai-1, or Boltz-1 and compare predictions across methods.
- Python: ESMFold API via `requests`, local ESMFold with `esm.pretrained`

Predict protein structures using state-of-the-art machine learning models. This covers cloud APIs, local installations, and interpretation of results.

## Model Comparison

| Model | Complexes | Ligands | Speed | Access |
|-------|-----------|---------|-------|--------|
| AlphaFold3 | Yes | Yes | Slow | Server only (2025) |
| ESMFold | No | No | Fast | API or local |
| Chai-1 | Yes | Yes | Moderate | Local or API |
| Boltz-1 | Yes | Yes | Moderate | Local |
| ColabFold | No* | No | Moderate | Colab/local |

*ColabFold can predict complexes with AlphaFold-Multimer.

## ESMFold (Fastest Single-Chain)

**Goal:** Predict a protein's 3D structure from its amino acid sequence using the ESMFold language model, which requires no MSA and runs in seconds.

**Approach:** Submit the sequence to the ESMFold API (or run locally with the esm library), retrieve the predicted PDB coordinates, and assess per-residue confidence via pLDDT scores in the B-factor column.

### Via ESM Atlas API

```python
import requests

def predict_esmfold(sequence):
    '''Predict structure using ESMFold API'''
    url = 'https://api.esmatlas.com/foldSequence/v1/pdb/'
    response = requests.post(url, data=sequence, timeout=300)
    if response.status_code == 200:
        return response.text
    raise Exception(f'ESMFold failed: {response.status_code}')

sequence = 'MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH'
pdb_text = predict_esmfold(sequence)
with open('predicted.pdb', 'w') as f:
    f.write(pdb_text)
```

### Local ESMFold

```python
import torch
import esm

def predict_esmfold_local(sequence, device='cuda'):
    '''Run ESMFold locally (requires ~16GB GPU memory)'''
    model = esm.pretrained.esmfold_v1()
    model = model.eval().to(device)

    with torch.no_grad():
        output = model.infer_pdb(sequence)
    return output

# Extract pLDDT from ESMFold output
def extract_esmfold_plddt(pdb_text):
    plddt = {}
    for line in pdb_text.split('\n'):
        if line.startswith('ATOM') and line[12:16].strip() == 'CA':
            resnum = int(line[22:26])
            bfactor = float(line[60:66])
            plddt[resnum] = bfactor
    return plddt
```

## AlphaFold3 (Server)

AlphaFold3 predictions via the server at alphafoldserver.com.

### Prepare Input JSON

```python
import json

def create_af3_input(sequences, job_name='prediction'):
    '''Create AlphaFold3 server input JSON'''
    entities = []
    for i, seq in enumerate(sequences):
        entities.append({
            'type': 'protein',
            'sequence': seq,
            'count': 1
        })

    job = {
        'name': job_name,
        'modelSeeds': [1],
        'sequences': entities
    }
    return json.dumps(job, indent=2)

# Single protein
input_json = create_af3_input(['MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH'])

# Protein complex
input_json = create_af3_input([
    'MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH',
    'MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSS'
])
```

### Process AF3 Results

```python
import json
from Bio.PDB import PDBParser
import numpy as np

def analyze_af3_result(result_dir):
    '''Analyze AlphaFold3 prediction results'''
    # Load summary
    with open(f'{result_dir}/summary_confidences.json') as f:
        summary = json.load(f)

    # Extract confidence metrics
    iptm = summary.get('iptm', None)  # Interface pTM (complexes)
    ptm = summary.get('ptm', None)    # Predicted TM-score
    ranking = summary.get('ranking_score', None)

    print(f'pTM: {ptm:.3f}' if ptm else 'pTM: N/A')
    print(f'ipTM: {iptm:.3f}' if iptm else 'ipTM: N/A')

    return summary
```

### AF3 Confidence Interpretation

| Metric | Range | Interpretation |
|--------|-------|----------------|
| pTM | 0-1 | Overall structure confidence |
| ipTM | 0-1 | Interface prediction quality |
| pLDDT | 0-100 | Per-residue confidence |
| PAE | 0-30A | Position error between residue pairs |

## Chai-1 (Local Open-Source)

### Installation

```bash
pip install chai-lab
```

### Basic Prediction

```python
from chai_lab.chai1 import run_inference
import numpy as np
from pathlib import Path

def predict_chai1(fasta_path, output_dir='chai_output'):
    '''Run Chai-1 structure prediction'''
    Path(output_dir).mkdir(exist_ok=True)

    candidates = run_inference(
        fasta_file=Path(fasta_path),
        output_dir=Path(output_dir),
        num_trunk_recycles=3,        # 3: Standard. Use 5+ for difficult targets.
        num_diffn_timesteps=200,     # 200: Standard. 500 for higher quality.
        seed=42,
        device='cuda:0'
    )
    return candidates

# Candidates are sorted by confidence
# candidates.cif files contain predicted structures
```

### Chai-1 with Ligands

```python
# Chai-1 supports protein-ligand complexes
# Include ligand SMILES in input FASTA with special format

def create_chai_fasta_with_ligand(protein_seq, ligand_smiles, output_file):
    '''Create Chai-1 input with protein and ligand'''
    with open(output_file, 'w') as f:
        f.write('>protein|chain_A\n')
        f.write(f'{protein_seq}\n')
        f.write('>ligand|chain_B\n')
        f.write(f'{ligand_smiles}\n')
```

## Boltz-1 (Open-Source Complex Prediction)

### Installation

```bash
pip install boltz
```

### Basic Prediction

```python
from boltz import Boltz1

def predict_boltz1(sequences, output_dir='boltz_output'):
    '''Run Boltz-1 structure prediction'''
    model = Boltz1()

    result = model.predict(
        sequences=sequences,
        output_dir=output_dir,
        recycling_steps=3,   # 3: Standard. Increase for difficult targets.
        sampling_steps=200   # 200: Standard. 500 for publication quality.
    )
    return result
```

### Boltz-1 for Complexes

```python
# Boltz-1 handles heteromeric complexes
def predict_complex_boltz(chain_sequences):
    '''Predict protein complex with Boltz-1'''
    model = Boltz1()

    result = model.predict(
        sequences=chain_sequences,  # List of sequences for each chain
        output_dir='complex_output'
    )

    # Extract interface metrics
    return result
```

## ColabFold (AlphaFold2 + MMseqs2)

### Command Line

```bash
# Install ColabFold
pip install colabfold

# Run prediction
colabfold_batch input.fasta output_dir/

# With custom templates
colabfold_batch input.fasta output_dir/ --templates

# For complexes (use : to separate chains)
# Create FASTA like: >complex\nSEQUENCE1:SEQUENCE2
```

### Python API

```python
from colabfold.batch import run_colabfold

def predict_colabfold(fasta_file, output_dir, use_templates=False):
    '''Run ColabFold prediction'''
    run_colabfold(
        input_path=fasta_file,
        result_dir=output_dir,
        use_templates=use_templates,
        num_models=5,           # 5: Standard. Use 1 for quick predictions.
        num_recycles=3,         # 3: Standard. Increase for multimers.
        model_order=[1,2,3,4,5]
    )
```

## Comparing Predictions

```python
from Bio.PDB import PDBParser, Superimposer
import numpy as np

def compare_predictions(pdb_files, labels=None):
    '''Compare multiple structure predictions'''
    parser = PDBParser(QUIET=True)
    structures = [parser.get_structure(f'model_{i}', f) for i, f in enumerate(pdb_files)]

    # Extract CA atoms from first chain
    def get_ca_atoms(struct):
        return [r['CA'] for r in struct[0].get_residues() if 'CA' in r]

    all_atoms = [get_ca_atoms(s) for s in structures]

    # Pairwise RMSD
    n = len(structures)
    rmsd_matrix = np.zeros((n, n))

    for i in range(n):
        for j in range(i+1, n):
            min_len = min(len(all_atoms[i]), len(all_atoms[j]))
            super_imposer = Superimposer()
            super_imposer.set_atoms(all_atoms[i][:min_len], all_atoms[j][:min_len])
            rmsd_matrix[i,j] = rmsd_matrix[j,i] = super_imposer.rms

    return rmsd_matrix

# Compare ESMFold vs AlphaFold3 vs Chai-1
rmsd = compare_predictions(['esmfold.pdb', 'af3.pdb', 'chai1.pdb'])
print('RMSD matrix:')
print(rmsd)
```

## When to Use Each Model

| Scenario | Recommended Model |
|----------|-------------------|
| Quick single-chain prediction | ESMFold (API) |
| Highest accuracy single chain | AlphaFold3 or ColabFold |
| Protein-protein complex | AlphaFold3, Chai-1, or Boltz-1 |
| Protein-ligand complex | AlphaFold3 or Chai-1 |
| No GPU available | ESMFold API or AlphaFold3 server |
| Large-scale screening | ESMFold (local) |
| Open-source requirement | Chai-1 or Boltz-1 |

## Memory Requirements

| Model | GPU Memory | Notes |
|-------|------------|-------|
| ESMFold | ~16 GB | Sequence length dependent |
| ColabFold | ~8-16 GB | Model size dependent |
| Chai-1 | ~24 GB | Complex size dependent |
| Boltz-1 | ~24 GB | Complex size dependent |

## Related Skills

- alphafold-predictions - Download pre-computed AlphaFold structures
- structure-io - Parse and write structure files
- geometric-analysis - RMSD, superimposition, distance calculations
- structure-navigation - Navigate predicted structure hierarchy

Attribution

BioTender-maxBioTender-max
View sourceMore from BioTender-max →
SSkills DirectorySkills Directory

Your tool, in front of Claude Code builders.

3 founder slots · $299/mo · GSC-verified traffic · sponsors can never buy grades.

See placements

Is this your skill, or is something wrong with this listing? Request removal or report an issue. Author removals are honored within 72 hours.

Comments (0)

No comments yet. Be the first to comment!

SSkills DirectorySkills Directory

Your tool, in front of Claude Code builders.

3 founder slots · $299/mo · GSC-verified traffic · sponsors can never buy grades.

See placements

Related Skills

Rank Tracker

This skill helps you track, analyze, and report on keyword ranking positions over time. It monitors both traditional SERP rankings and AI/GEO visibility to provide comprehensive search performance insights.

1821 votes

Youtube Competitor Analyzer

Find and analyze YouTube competitor channels using YouTube Data API v3. Discover competitors through keyword search, category matching, content similarity, and related channel discovery. Compare metrics, content strategies, and market positioning. Use when users want to (1) Find competitors for their YouTube channel, (2) Analyze competitor performance metrics, (3) Compare their channel against competitors, (4) Identify content gaps and opportunities, (5) Benchmark against similar creators, (6...

31 votes

Twitter Algorithm Optimizer

Analyze and optimize tweets for maximum reach using Twitter's open-source algorithm insights. Rewrite and edit user tweets to improve engagement and visibility based on how the recommendation system ranks content.

742580 votes

Weather Fetcher

Instructions for fetching current weather temperature data for Karachi, Pakistan from wttr.in API

661090 votes

Weather

Get current weather and forecasts (no API key required).

480640 votes
View all in data →