Design novel protein therapeutics (binders, enzymes, scaffolds) using AI-guided de novo design. Uses RFdiffusion for backbone generation, ProteinMPNN for sequence design, ESMFold/AlphaFold2 for validation. Use when asked to design protein binders, therapeutic proteins, or engineer protein function.
Scanned 5/29/2026
Install to Claude Code
npx -y skills add FreedomIntelligence/OpenClaw-Medical-Skills --skill tooluniverse-protein-therapeutic-design --agent claude-codeInstalls into .claude/skills of the current project.
Are you the author of Tooluniverse Protein Therapeutic Design?
Add the live security badge to your README — it updates automatically with every re-scan.
[](https://www.skillsdirectory.com/skills/freedomintelligence-tooluniverse-protein-therapeutic-design)More formats (shields.io, HTML) on the badges page.
---
name: tooluniverse-protein-therapeutic-design
description: Design novel protein therapeutics (binders, enzymes, scaffolds) using AI-guided de novo design. Uses RFdiffusion for backbone generation, ProteinMPNN for sequence design, ESMFold/AlphaFold2 for validation. Use when asked to design protein binders, therapeutic proteins, or engineer protein function.
---
# Therapeutic Protein Designer
AI-guided de novo protein design using RFdiffusion backbone generation, ProteinMPNN sequence optimization, and structure validation for therapeutic protein development.
**KEY PRINCIPLES**:
1. **Structure-first design** - Generate backbone geometry before sequence
2. **Target-guided** - Design binders with target structure in mind
3. **Iterative validation** - Predict structure to validate designs
4. **Developability-aware** - Consider aggregation, immunogenicity, expression
5. **Evidence-graded** - Grade designs by confidence metrics
6. **Actionable output** - Provide sequences ready for experimental testing
7. **English-first queries** - Always use English terms in tool calls (protein names, target names), even if the user writes in another language. Only try original-language terms as a fallback. Respond in the user's language
---
## When to Use
Apply when user asks:
- "Design a protein binder for [target]"
- "Create a therapeutic protein against [protein/epitope]"
- "Design a protein scaffold with [property]"
- "Optimize this protein sequence for [function]"
- "Design a de novo enzyme for [reaction]"
- "Generate protein variants for [target binding]"
---
## Critical Workflow Requirements
### 1. Report-First Approach (MANDATORY)
1. **Create the report file FIRST**:
- File name: `[TARGET]_protein_design_report.md`
- Initialize with section headers
- Add placeholder: `[Designing...]`
2. **Progressively update** as designs are generated
3. **Output separate files**:
- `[TARGET]_designed_sequences.fasta` - All designed sequences
- `[TARGET]_top_candidates.csv` - Ranked candidates with metrics
### 2. Design Documentation (MANDATORY)
Every design MUST include:
```markdown
### Design: Binder_001
**Sequence**: MVLSPADKTN...
**Length**: 85 amino acids
**Target**: PD-L1 (UniProt: Q9NZQ7)
**Method**: RFdiffusion → ProteinMPNN → ESMFold validation
**Quality Metrics**:
| Metric | Value | Interpretation |
|--------|-------|----------------|
| pLDDT | 88.5 | High confidence |
| pTM | 0.82 | Good fold |
| ProteinMPNN score | -2.3 | Favorable |
| Predicted binding | Strong | Based on interface pLDDT |
*Source: NVIDIA NIM via `NvidiaNIM_rfdiffusion`, `NvidiaNIM_proteinmpnn`, `NvidiaNIM_esmfold`*
```
---
## Phase 0: Tool Verification
### NVIDIA NIM Tools Required
| Tool | Purpose | API Key Required |
|------|---------|------------------|
| `NvidiaNIM_rfdiffusion` | Backbone generation | Yes |
| `NvidiaNIM_proteinmpnn` | Sequence design | Yes |
| `NvidiaNIM_esmfold` | Fast structure validation | Yes |
| `NvidiaNIM_alphafold2` | High-accuracy validation | Yes |
| `NvidiaNIM_esm2_650m` | Sequence embeddings | Yes |
### Parameter Verification
| Tool | WRONG Parameter | CORRECT Parameter |
|------|-----------------|-------------------|
| `NvidiaNIM_rfdiffusion` | `num_steps` | `diffusion_steps` |
| `NvidiaNIM_proteinmpnn` | `pdb` | `pdb_string` |
| `NvidiaNIM_esmfold` | `seq` | `sequence` |
---
## Workflow Overview
```
Phase 1: Target Characterization
├── Get target structure (PDB, EMDB cryo-EM, or AlphaFold)
├── Identify binding epitope
├── Analyze existing binders
├── Check EMDB for membrane protein structures (NEW)
└── OUTPUT: Target profile
↓
Phase 2: Backbone Generation (RFdiffusion)
├── Define design constraints
├── Generate multiple backbones
├── Filter by geometry quality
└── OUTPUT: Candidate backbones
↓
Phase 3: Sequence Design (ProteinMPNN)
├── Design sequences for each backbone
├── Sample multiple sequences per backbone
├── Score by ProteinMPNN likelihood
└── OUTPUT: Designed sequences
↓
Phase 4: Structure Validation
├── Predict structure (ESMFold/AlphaFold2)
├── Compare to designed backbone
├── Assess fold quality (pLDDT, pTM)
└── OUTPUT: Validated designs
↓
Phase 5: Developability Assessment
├── Aggregation propensity
├── Expression likelihood
├── Immunogenicity prediction
└── OUTPUT: Developability scores
↓
Phase 6: Report Synthesis
├── Ranked candidate list
├── Experimental recommendations
├── Next steps
└── OUTPUT: Final report
```
---
## Phase 1: Target Characterization
### 1.1 Get Target Structure
```python
def get_target_structure(tu, target_id):
"""Get target structure from PDB, EMDB, or predict."""
# Try PDB first (X-ray/NMR)
pdb_results = tu.tools.PDB_search_by_uniprot(uniprot_id=target_id)
if pdb_results:
# Get highest resolution structure
best_pdb = sorted(pdb_results, key=lambda x: x['resolution'])[0]
structure = tu.tools.PDB_get_structure(pdb_id=best_pdb['pdb_id'])
return {'source': 'PDB', 'pdb_id': best_pdb['pdb_id'],
'resolution': best_pdb['resolution'], 'structure': structure}
# Try EMDB for cryo-EM structures (valuable for membrane proteins)
protein_info = tu.tools.UniProt_get_protein_by_accession(accession=target_id)
emdb_results = tu.tools.emdb_search(
query=protein_info['proteinDescription']['recommendedName']['fullName']['value']
)
if emdb_results and len(emdb_results) > 0:
# Get highest resolution cryo-EM entry
best_emdb = sorted(emdb_results, key=lambda x: x.get('resolution', 99))[0]
# Get associated PDB model if available
emdb_details = tu.tools.emdb_get_entry(entry_id=best_emdb['emdb_id'])
if emdb_details.get('pdb_ids'):
structure = tu.tools.PDB_get_structure(pdb_id=emdb_details['pdb_ids'][0])
return {'source': 'EMDB cryo-EM', 'emdb_id': best_emdb['emdb_id'],
'pdb_id': emdb_details['pdb_ids'][0],
'resolution': best_emdb.get('resolution'), 'structure': structure}
# Fallback to AlphaFold prediction
sequence = tu.tools.UniProt_get_protein_sequence(accession=target_id)
structure = tu.tools.NvidiaNIM_alphafold2(
sequence=sequence['sequence'],
algorithm="mmseqs2"
)
return {'source': 'AlphaFold2 (predicted)', 'structure': structure}
```
### 1.1b EMDB for Membrane Proteins (NEW)
**When to prioritize EMDB**: Membrane proteins, large complexes, and targets where conformational states matter.
```python
def get_cryoem_structures(tu, target_name):
"""Get cryo-EM structures for membrane proteins/complexes."""
# Search EMDB
emdb_results = tu.tools.emdb_search(
query=f"{target_name} membrane OR receptor"
)
structures = []
for entry in emdb_results[:5]:
details = tu.tools.emdb_get_entry(entry_id=entry['emdb_id'])
structures.append({
'emdb_id': entry['emdb_id'],
'resolution': entry.get('resolution', 'N/A'),
'title': entry.get('title', 'N/A'),
'conformational_state': details.get('state', 'Unknown'),
'pdb_models': details.get('pdb_ids', [])
})
return structures
```
**Output for Report**:
```markdown
### 1.1b Cryo-EM Structures (EMDB)
| EMDB ID | Resolution | PDB Model | Conformation |
|---------|------------|-----------|--------------|
| EMD-12345 | 2.8 Å | 7ABC | Active state |
| EMD-23456 | 3.1 Å | 8DEF | Inactive state |
**Note**: Cryo-EM structures capture physiologically relevant conformations for membrane protein targets.
*Source: EMDB*
```
### 1.2 Identify Binding Epitope
```python
def identify_epitope(tu, target_structure, epitope_residues=None):
"""Identify or validate binding epitope."""
if epitope_residues:
# User-specified epitope
return {'residues': epitope_residues, 'source': 'user-defined'}
# Find surface-exposed regions
# Use structural analysis to identify potential epitopes
return analyze_surface(target_structure)
```
### 1.3 Output for Report
```markdown
## 1. Target Characterization
### 1.1 Target Information
| Property | Value |
|----------|-------|
| **Target** | PD-L1 (Programmed death-ligand 1) |
| **UniProt** | Q9NZQ7 |
| **Structure source** | PDB: 4ZQK (2.0 Å resolution) |
| **Binding epitope** | IgV domain, residues 19-127 |
| **Known binders** | Atezolizumab, durvalumab, avelumab |
### 1.2 Epitope Analysis
| Residue Range | Type | Surface Area | Druggability |
|---------------|------|--------------|--------------|
| 54-68 | Loop | 850 Ų | High |
| 115-125 | Beta strand | 420 Ų | Medium |
| 19-30 | N-terminus | 380 Ų | Medium |
**Selected Epitope**: Residues 54-68 (PD-1 binding interface)
*Source: PDB 4ZQK, surface analysis*
```
---
## Phase 2: Backbone Generation
### 2.1 RFdiffusion Design
```python
def generate_backbones(tu, design_params):
"""Generate de novo backbones using RFdiffusion."""
backbones = tu.tools.NvidiaNIM_rfdiffusion(
diffusion_steps=design_params.get('steps', 50),
# Additional parameters depending on design type
)
return backbones
```
### 2.2 Design Modes
| Mode | Use Case | Key Parameters |
|------|----------|----------------|
| **Unconditional** | De novo scaffold | `diffusion_steps` only |
| **Binder design** | Target-guided binder | `target_structure`, `hotspot_residues` |
| **Motif scaffolding** | Functional motif embedding | `motif_sequence`, `motif_structure` |
### 2.3 Output for Report
```markdown
## 2. Backbone Generation
### 2.1 Design Parameters
| Parameter | Value |
|-----------|-------|
| **Method** | RFdiffusion via NVIDIA NIM |
| **Design mode** | Unconditional scaffold generation |
| **Diffusion steps** | 50 |
| **Number generated** | 10 backbones |
### 2.2 Generated Backbones
| Backbone | Length | Topology | Quality |
|----------|--------|----------|---------|
| BB_001 | 85 aa | 3-helix bundle | Good |
| BB_002 | 92 aa | Beta sandwich | Good |
| BB_003 | 78 aa | Alpha-beta | Good |
| BB_004 | 88 aa | All-alpha | Moderate |
| BB_005 | 95 aa | Mixed | Good |
**Selected for sequence design**: BB_001, BB_002, BB_003, BB_005 (top 4)
*Source: NVIDIA NIM via `NvidiaNIM_rfdiffusion`*
```
---
## Phase 3: Sequence Design
### 3.1 ProteinMPNN Design
```python
def design_sequences(tu, backbone_pdb, num_sequences=8):
"""Design sequences for backbone using ProteinMPNN."""
sequences = tu.tools.NvidiaNIM_proteinmpnn(
pdb_string=backbone_pdb,
num_sequences=num_sequences,
temperature=0.1 # Lower = more conservative
)
return sequences
```
### 3.2 Sampling Parameters
| Parameter | Conservative | Moderate | Diverse |
|-----------|--------------|----------|---------|
| Temperature | 0.1 | 0.2 | 0.5 |
| Sequences per backbone | 4 | 8 | 16 |
| Use case | Validated scaffold | Exploration | Diversity |
### 3.3 Output for Report
```markdown
## 3. Sequence Design
### 3.1 Design Parameters
| Parameter | Value |
|-----------|-------|
| **Method** | ProteinMPNN via NVIDIA NIM |
| **Temperature** | 0.1 (conservative) |
| **Sequences per backbone** | 8 |
| **Total sequences** | 32 |
### 3.2 Designed Sequences (Top 10 by Score)
| Rank | Backbone | Sequence ID | Length | MPNN Score | Predicted pI |
|------|----------|-------------|--------|------------|--------------|
| 1 | BB_001 | Seq_001_A | 85 | -1.89 | 6.2 |
| 2 | BB_002 | Seq_002_C | 92 | -1.95 | 5.8 |
| 3 | BB_001 | Seq_001_B | 85 | -2.01 | 7.1 |
| 4 | BB_003 | Seq_003_A | 78 | -2.08 | 6.5 |
| 5 | BB_005 | Seq_005_B | 95 | -2.12 | 5.4 |
### 3.3 Top Sequence: Seq_001_A
```
>Seq_001_A (85 aa, MPNN score: -1.89)
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH
GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL
```
*Source: NVIDIA NIM via `NvidiaNIM_proteinmpnn`*
```
---
## Phase 4: Structure Validation
### 4.1 ESMFold Validation
```python
def validate_structure(tu, sequence):
"""Validate designed sequence by structure prediction."""
# Fast validation with ESMFold
predicted = tu.tools.NvidiaNIM_esmfold(sequence=sequence)
# Extract quality metrics
plddt = extract_plddt(predicted)
ptm = extract_ptm(predicted)
return {
'structure': predicted,
'mean_plddt': np.mean(plddt),
'ptm': ptm,
'passes': np.mean(plddt) > 70 and ptm > 0.7
}
```
### 4.2 Validation Criteria
| Metric | Threshold | Interpretation |
|--------|-----------|----------------|
| Mean pLDDT | >70 | Confident fold |
| pTM | >0.7 | Good global topology |
| RMSD to backbone | <2 Å | Design recapitulated |
### 4.3 Output for Report
```markdown
## 4. Structure Validation
### 4.1 Validation Results
| Sequence | pLDDT | pTM | RMSD to Design | Status |
|----------|-------|-----|----------------|--------|
| Seq_001_A | 88.5 | 0.85 | 1.2 Å | ✓ PASS |
| Seq_002_C | 82.3 | 0.79 | 1.5 Å | ✓ PASS |
| Seq_001_B | 85.1 | 0.82 | 1.3 Å | ✓ PASS |
| Seq_003_A | 79.8 | 0.76 | 1.8 Å | ✓ PASS |
| Seq_005_B | 68.2 | 0.65 | 2.8 Å | ✗ FAIL |
### 4.2 Top Validated Design: Seq_001_A
| Region | Residues | pLDDT | Interpretation |
|--------|----------|-------|----------------|
| Helix 1 | 1-28 | 92.3 | Very high confidence |
| Loop 1 | 29-35 | 78.4 | Moderate confidence |
| Helix 2 | 36-58 | 91.8 | Very high confidence |
| Loop 2 | 59-65 | 75.2 | Moderate confidence |
| Helix 3 | 66-85 | 90.1 | Very high confidence |
**Overall**: Well-folded 3-helix bundle with high confidence core
*Source: NVIDIA NIM via `NvidiaNIM_esmfold`*
```
---
## Phase 5: Developability Assessment
### 5.1 Aggregation Propensity
```python
def assess_aggregation(sequence):
"""Assess aggregation propensity."""
# Calculate hydrophobic patches
# Calculate isoelectric point
# Identify aggregation-prone motifs
return {
'aggregation_score': score,
'hydrophobic_patches': patches,
'risk_level': 'Low' if score < 0.5 else 'Medium' if score < 0.7 else 'High'
}
```
### 5.2 Developability Metrics
| Metric | Favorable | Marginal | Unfavorable |
|--------|-----------|----------|-------------|
| Aggregation score | <0.5 | 0.5-0.7 | >0.7 |
| Isoelectric point | 5-9 | 4-5 or 9-10 | <4 or >10 |
| Hydrophobic patches | <3 | 3-5 | >5 |
| Cysteine count | 0 or even | Odd | Multiple unpaired |
### 5.3 Output for Report
```markdown
## 5. Developability Assessment
### 5.1 Developability Scores
| Design | Aggregation | pI | Cysteines | Expression | Overall |
|--------|-------------|-----|-----------|------------|---------|
| Seq_001_A | 0.32 (Low) | 6.2 | 0 | High | ★★★ |
| Seq_002_C | 0.45 (Low) | 5.8 | 2 (paired) | Medium | ★★☆ |
| Seq_001_B | 0.38 (Low) | 7.1 | 0 | High | ★★★ |
| Seq_003_A | 0.58 (Med) | 6.5 | 0 | Medium | ★★☆ |
### 5.2 Recommendations
**Best candidate for expression**: Seq_001_A
- Low aggregation propensity
- Neutral pI (easy purification)
- No cysteines (no misfolding risk)
- Predicted high E. coli expression
*Source: Sequence analysis*
```
---
## Report Template
```markdown
# Therapeutic Protein Design Report: [TARGET]
**Generated**: [Date] | **Query**: [Original query] | **Status**: In Progress
---
## Executive Summary
[Designing...]
---
## 1. Target Characterization
### 1.1 Target Information
[Designing...]
### 1.2 Binding Epitope
[Designing...]
---
## 2. Backbone Generation
### 2.1 Design Parameters
[Designing...]
### 2.2 Generated Backbones
[Designing...]
---
## 3. Sequence Design
### 3.1 ProteinMPNN Results
[Designing...]
### 3.2 Top Sequences
[Designing...]
---
## 4. Structure Validation
### 4.1 ESMFold Validation
[Designing...]
### 4.2 Quality Metrics
[Designing...]
---
## 5. Developability Assessment
### 5.1 Scores
[Designing...]
### 5.2 Recommendations
[Designing...]
---
## 6. Final Candidates
### 6.1 Ranked List
[Designing...]
### 6.2 Sequences for Testing
[Designing...]
---
## 7. Experimental Recommendations
[Designing...]
---
## 8. Data Sources
[Will be populated...]
```
---
## Evidence Grading
| Tier | Symbol | Criteria |
|------|--------|----------|
| **T1** | ★★★ | pLDDT >85, pTM >0.8, low aggregation, neutral pI |
| **T2** | ★★☆ | pLDDT >75, pTM >0.7, acceptable developability |
| **T3** | ★☆☆ | pLDDT >70, pTM >0.65, developability concerns |
| **T4** | ☆☆☆ | Failed validation or major developability issues |
---
## Completeness Checklist
### Phase 1: Target
- [ ] Target structure obtained (PDB or predicted)
- [ ] Binding epitope identified
- [ ] Existing binders noted
### Phase 2: Backbones
- [ ] ≥5 backbones generated
- [ ] Top 3-5 selected for sequence design
- [ ] Selection criteria documented
### Phase 3: Sequences
- [ ] ≥8 sequences per backbone designed
- [ ] MPNN scores reported
- [ ] Top 10 sequences listed
### Phase 4: Validation
- [ ] All sequences validated by ESMFold
- [ ] pLDDT and pTM reported
- [ ] Pass/fail criteria applied
- [ ] ≥3 passing designs
### Phase 5: Developability
- [ ] Aggregation assessed
- [ ] pI calculated
- [ ] Expression prediction
- [ ] Final ranking
### Phase 6: Deliverables
- [ ] Ranked candidate list
- [ ] FASTA file with sequences
- [ ] Experimental recommendations
---
## Fallback Chains
| Primary Tool | Fallback 1 | Fallback 2 |
|--------------|------------|------------|
| `NvidiaNIM_rfdiffusion` | Manual backbone design | Scaffold from PDB |
| `NvidiaNIM_proteinmpnn` | Rosetta ProteinMPNN | Manual sequence design |
| `NvidiaNIM_esmfold` | `NvidiaNIM_alphafold2` | AlphaFold DB |
| PDB structure | `NvidiaNIM_alphafold2` | AlphaFold DB |
---
## Tool Reference
See [TOOLS_REFERENCE.md](TOOLS_REFERENCE.md) for complete tool documentation.
Is this your skill, or is something wrong with this listing? Request removal or report an issue. Author removals are honored within 72 hours.
No comments yet. Be the first to comment!